SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29568111|ref|NP_006088.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29568111|ref|NP_006088.2|
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 2.01e-42
Family Calmodulin-like 0.0000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29568111|ref|NP_006088.2|
Sequence length 172
Comment myosin regulatory light polypeptide 9 isoform a [Homo sapiens]
Sequence
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A091MG90 A0A096NUK6 A0A0D9RCB0 A0A0Q3M7R3 A0A218UJ79 A0A2I0U2P2 A0A2I2U033 A0A2I3GV71 A0A2J8VJH4 A0A2K5DJZ2 A0A2K5HE57 A0A2K5LRP2 A0A2K5XH89 A0A2K6E2R2 A0A2K6KCA6 A0A2K6NEQ6 A0A2K6V5G6 D2H464 F1P634 F7IBQ4 G3GXV8 G3RR26 G5B837 G7N4X7 G7PGH0 H0VRA0 H0WHF0 H2QKA3 L5LT62 M3Z255 P24844 P29269 Q5RBA4 R7VTG3 S7MZU3
ENSSSCP00000026757 NP_001125549.1.23681 NP_001231401.1.46622 NP_001239095.1.84170 NP_006088.2.87134 NP_006088.2.92137 XP_002189809.1.42559 XP_002710827.1.1745 XP_002747256.1.60252 XP_002916465.1.58354 XP_003253570.1.23891 XP_003339391.1.37143 XP_003467681.1.53824 XP_003497135.1.69978 XP_003788189.1.62490 XP_003831931.1.60992 XP_003932060.1.74449 XP_003983604.1.62641 XP_004090160.1.23891 XP_004272854.1.21590 XP_004393201.1.74151 XP_004585841.1.84141 XP_004630936.1.9945 XP_004698023.1.18182 XP_004746553.1.14098 XP_004867894.1.39548 XP_005057022.1.66865 XP_005146815.1.78019 XP_005244586.1.75256 XP_005384802.1.28644 XP_005428432.1.5688 XP_005435041.1.10750 XP_005512265.1.63277 XP_005568977.1.63531 XP_005868537.1.60319 XP_005868538.1.60319 XP_006144153.1.99106 XP_006144154.1.99106 XP_006742597.1.47382 XP_006764585.1.95426 XP_006764586.1.95426 XP_006875784.1.41390 XP_006921841.1.64745 XP_006984214.1.50099 XP_006984215.1.50099 XP_007077746.1.5354 XP_007104513.1.24612 XP_007193241.1.59432 XP_007447807.1.90284 XP_007605923.2.69978 XP_007616695.1.28591 XP_007616696.1.28591 XP_007962247.1.81039 XP_008147876.1.99482 XP_008489372.1.100939 XP_008641694.1.15636 XP_008849393.1.79516 XP_008932593.1.51550 XP_008932593.1.96775 XP_009071463.1.14518 XP_009071471.1.14518 XP_009097021.2.15306 XP_009231828.1.23681 XP_009471585.1.38621 XP_009563664.1.62272 XP_009636247.1.23211 XP_009884632.1.48241 XP_009936890.1.35112 XP_009948037.1.99599 XP_010159593.1.22856 XP_010304035.1.13389 XP_010384880.1.97406 XP_010411469.1.2935 XP_010562874.1.12557 XP_010562875.1.12557 XP_010638299.1.5607 XP_010638300.1.5607 XP_011364870.1.92234 XP_011596111.1.59079 XP_011740687.1.29376 XP_011764907.1.29376 XP_011784503.1.43180 XP_011827742.1.47321 XP_011827743.1.47321 XP_011827744.1.47321 XP_011827745.1.47321 XP_011908146.1.92194 XP_012310492.1.9421 XP_012610211.1.48125 XP_013369460.1.28644 XP_013962316.1.84170 XP_014312012.1.53796 XP_014793084.1.91963 XP_014932630.1.86478 XP_015004541.1.72884 XP_016003830.1.101085 XP_016074888.1.3490 XP_016077675.1.3490 XP_017197129.1.1745 XP_017500672.1.32401 XP_017658213.1.79516 XP_017658214.1.79516 XP_017691112.1.3805 XP_017719011.1.44346 XP_018872502.1.27298 XP_019314128.1.44245 XP_019510749.1.44202 XP_020040822.1.5219 XP_021392278.1.53032 XP_021506643.1.76796 XP_021545026.1.83697 ENSMPUP00000017667 ENSPTRP00000023100 ENSFCAP00000004476 ENSPPYP00000012253 ENSCAFP00000012547 ENSGGOP00000018250 ENSCPOP00000006156 HGL_H00000279022 ENSOGAP00000000793 ENSCAFP00000012547 gi|29568111|ref|NP_006088.2| ENSPVAP00000001027 ENSCPOP00000006156 ENSGGOP00000018250 ENSMICP00000000331 ENSSSCP00000026757 ENSCJAP00000002390 ENSCJAP00000002390 ENSMICP00000000331 ENSPTRP00000023100 ENSPVAP00000001027 ENSFCAP00000016402 ENSTTRP00000001284 ENSPPYP00000012253 ENSTTRP00000001284 ENSP00000279022 ENSNLEP00000007415 ENSP00000279022 ENSMPUP00000017667 ENSPANP00000016730 10141.ENSCPOP00000006156 9598.ENSPTRP00000023100 9600.ENSPPYP00000012253 9606.ENSP00000279022 9685.ENSFCAP00000004476 9823.ENSSSCP00000007791 9823.ENSSSCP00000007794 ENSOGAP00000000793 ENSP00000217313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]