SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296011073|ref|NP_001171622.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296011073|ref|NP_001171622.1|
Domain Number 1 Region: 420-562
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-22
Family MAM domain 0.00082
Further Details:      
 
Domain Number 2 Region: 186-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|296011073|ref|NP_001171622.1|
Domain Number - Region: 53-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296011073|ref|NP_001171622.1|
Sequence length 566
Comment nephronectin isoform E precursor [Homo sapiens]
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDEHIPAPLDQGSEQPLFQPLDHQATSLPSRDL
NECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIR
CQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKY
QCHDIDECSLGQYQCSSFARCYNIRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVP
KGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPTPIPTPPP
PPPLPTELRTPLPPTTPERPTTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFSVLV
HSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSG
DLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKG
EKRRGHTGEIGLDDVSLKKGHCSEER
Download sequence
Identical sequences ENSP00000422474 ENSP00000422474 gi|296011073|ref|NP_001171622.1| NP_001171622.1.87134 NP_001171622.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]