SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296080775|ref|NP_001171679.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296080775|ref|NP_001171679.1|
Domain Number 1 Region: 361-551
Classification Level Classification E-value
Superfamily L domain-like 2.62e-38
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 35-263
Classification Level Classification E-value
Superfamily L domain-like 3.13e-34
Family Ngr ectodomain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296080775|ref|NP_001171679.1|
Sequence length 837
Comment SLIT and NTRK-like protein 4 precursor [Homo sapiens]
Sequence
MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSN
FYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELK
ILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASL
THLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEA
ICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLV
TKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVN
CQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYL
NNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLV
ALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITF
TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPD
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVV
MRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIR
YPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI
Download sequence
Identical sequences Q8IW52
NP_001171678.1.87134 NP_001171678.1.92137 NP_001171679.1.87134 NP_001171679.1.92137 NP_775101.1.87134 NP_775101.1.92137 XP_005262422.1.92137 XP_011529567.1.92137 ENSP00000336627 gi|27436867|ref|NP_775101.1| gi|296080773|ref|NP_001171678.1| gi|296080775|ref|NP_001171679.1| ENSP00000336627 ENSP00000349400 ENSP00000371198 ENSP00000469205 ENSP00000469732 9606.ENSP00000336627 ENSP00000336627 ENSP00000349400 ENSP00000469205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]