SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296278229|ref|NP_078781.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296278229|ref|NP_078781.3|
Domain Number 1 Region: 27-110,139-204
Classification Level Classification E-value
Superfamily EF-hand 2.36e-26
Family Calmodulin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 445-526,564-574
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.24e-19
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 580-765
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.000000000000924
Family Flavohemoglobin, C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296278229|ref|NP_078781.3|
Sequence length 765
Comment NADPH oxidase 5 isoform 1 [Homo sapiens]
Sequence
MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF
FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTE
WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD
GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQLTRAYWHNHRSQLF
CLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW
LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGI
GWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW
KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN
IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVT
MRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL
QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQ
AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDW
SKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
Download sequence
Identical sequences Q96PH1
ENSP00000373518 gi|296278229|ref|NP_078781.3| NP_078781.3.87134 NP_078781.3.92137 ENSP00000373518 ENSP00000416828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]