SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296531339|ref|NP_001171812.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296531339|ref|NP_001171812.1|
Domain Number 1 Region: 251-423,467-640
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.45e-130
Family Mammalian PLC 0.00000000262
Further Details:      
 
Domain Number 2 Region: 872-1131
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.79e-63
Family C-terminal domain of PLC-beta 0.00033
Further Details:      
 
Domain Number 3 Region: 81-247
Classification Level Classification E-value
Superfamily EF-hand 9.53e-51
Family EF-hand modules in multidomain proteins 0.00000945
Further Details:      
 
Domain Number 4 Region: 661-774
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-23
Family PLC-like (P variant) 0.0000382
Further Details:      
 
Domain Number 5 Region: 17-79
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000627
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296531339|ref|NP_001171812.1|
Sequence length 1167
Comment 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3 isoform 2 [Homo sapiens]
Sequence
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEEKLMTVVSGPDPVNTVFLNFMAVQDDT
AKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVE
TALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLM
DFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYLGGEENGI
LPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWK
GRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAE
YCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPL
EQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGP
YVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEA
ARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNV
GCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVANA
LRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPFDFPKVV
LPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLIYTEASDY
IPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQLGSQPSSN
PTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGHKALVKLR
SRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVEDTKEGEDE
AKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMN
EREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRH
DRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLGDGPLVAC
ASNGHAPGSSGHLSGADSESQEENTQL
Download sequence
Identical sequences ENSP00000324660 NP_001171812.1.87134 NP_001171812.1.92137 ENSP00000324660 gi|296531339|ref|NP_001171812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]