SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297374815|ref|NP_001172024.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297374815|ref|NP_001172024.1|
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000593
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297374815|ref|NP_001172024.1|
Sequence length 176
Comment allograft inflammatory factor 1-like isoform 3 [Homo sapiens]
Sequence
MSGELSNRFQGGKAFGLLKARQERRLAEINRYCAGREPQLQRISCSQHSCLLALLFQEFL
CDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISE
VTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Download sequence
Identical sequences ENSP00000361383 gi|297374815|ref|NP_001172024.1| ENSP00000361383 NP_001172024.1.87134 NP_001172024.1.92137 ENSP00000361386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]