SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297374818|ref|NP_001172025.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297374818|ref|NP_001172025.1|
Domain Number 1 Region: 41-100
Classification Level Classification E-value
Superfamily EF-hand 0.00000000466
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297374818|ref|NP_001172025.1|
Sequence length 102
Comment allograft inflammatory factor 1-like isoform 4 [Homo sapiens]
Sequence
MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFD
LNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGSHDV
Download sequence
Identical sequences A0A2J8NAT0 A0A2J8UJD4
NP_001172025.1.87134 NP_001172025.1.92137 ENSP00000361374 gi|297374818|ref|NP_001172025.1| ENSP00000361374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]