SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|299758423|ref|NP_001177652.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299758423|ref|NP_001177652.1|
Domain Number 1 Region: 34-185
Classification Level Classification E-value
Superfamily L domain-like 1.28e-30
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 2 Region: 544-604
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000118
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 640-689
Classification Level Classification E-value
Superfamily RING/U-box 0.00000261
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  gi|299758423|ref|NP_001177652.1|
Domain Number - Region: 295-352
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.00798
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|299758423|ref|NP_001177652.1|
Sequence length 696
Comment E3 ubiquitin-protein ligase LRSAM1 isoform 2 [Homo sapiens]
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLP
RSIGNLTQLQTLNVKDNKLKELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHTQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQEMISEQ
RWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQE
EGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQ
ELLDAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIF
LNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIYHSS
Download sequence
Identical sequences ENSP00000362421 ENSP00000362421 NP_001177652.1.87134 NP_001177652.1.92137 gi|299758423|ref|NP_001177652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]