SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|299782601|ref|NP_001010847.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299782601|ref|NP_001010847.1|
Domain Number 1 Region: 26-228
Classification Level Classification E-value
Superfamily L domain-like 2.04e-40
Family Ngr ectodomain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|299782601|ref|NP_001010847.1|
Sequence length 294
Comment leucine-rich repeat-containing protein 38 [Homo sapiens]
Sequence
MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRK
LLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLG
AGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRS
LRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCSLPMESRRISLRELSEASFSECR
FSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD
Download sequence
Identical sequences Q5VT99
ENSP00000365253 gi|299782601|ref|NP_001010847.1| ENSP00000365253 NP_001010847.1.87134 NP_001010847.1.92137 ENSP00000365253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]