SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|299829223|ref|NP_775919.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299829223|ref|NP_775919.3|
Domain Number 1 Region: 1407-1500
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 47-127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000082
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 209-352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000134
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  gi|299829223|ref|NP_775919.3|
Domain Number - Region: 975-1119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number - Region: 132-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000533
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number - Region: 863-1009
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 699-768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0617
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 352-450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|299829223|ref|NP_775919.3|
Sequence length 1530
Comment coiled-coil domain-containing protein 141 [Homo sapiens]
Sequence
MSSQGSPSVALSTTTVSSVAVQAGDSKIVIAVIKCGKWVQLQLAESQPNLLEIGSSQDET
KKLLHDHELLLAKLKALEDRVWELLQEADKTAEENKDQSQVYDAMAETLGEAWAALVSML
ERRTELLRLTSEFFENALEFAIKIDQAEDFLQNTHEFESAESLKSLLQLHEHHTKELLER
SLALLNKSQQLTDFIEKFKCEGPNVNPELTQGAHSSCLKVDRLLELLQDRRRQLDKYLKQ
QWQELSQVLQICQWDQQENQVTCWFQKTIRNLQEQSLGSSLSDNEDRIHKQEELIIKAKE
WNSAVEKLKSEALRILLSKDYVEKEHLQLSHQKLSQLQEEFGQLMVERNTWLKKANEFFN
SANKAFDVLGRVEAYLKLLKSEGLSLAVLAVRHEELHRKIKDCTTDALQKGQTLISQVDS
CSSQVSGIHEMMGCIKRRVDHLTEQCSAHKEYALKKQQLTASVEGYLRKVEMSIQKISPV
LSNAMDVGSTRSESEKILNKYLELDIQAKETSHELEAAAKTMMEKNEFVSDEMVSLSSKA
RWLAEELNLFGQSIDYRSQVLQTYVAFLKSSEEVEMQFQSLKEFYETEIPQKEQDDAKAK
HCSDSAEKQWQLFLKKSFITQDLGLEFLNLINMAKENEILDVKNEVYLMKNTMENQKAER
EELSLLRLAWQLKATESKPGKQQWAAFKEQLKKTSHNLKLLQEALMPVSALDLGGSLQFI
LDLRQKWNDMKPQFQQLNDEVQYIMKESEELTGRGAPVKEKSQQLKDLIHFHQKQKERIQ
DYEDILYKVVQFHQVKEELGRLIKSRELEFVEQPKELGDAHDVQIHLRCSQEKQARVDHL
HRLALSLGVDIISSVQRPHCSNVSAKNLQQQLELLEEDSMKWRAKAEEYGRTLSRSVEYC
AMRDEINELKDSFKDIKKKFNNLKFNYTKKNEKSRNLKALKYQIQQVDMYAEKMQALKRK
MEKVSNKTSDSFLNYPSDKVNVLLEVMKDLQKHVDDFDKVVTDYKKNLDLTEHFQEVIEE
CHFWYEDASATVVRVGKYSTECKTKEAVKILHQQFNKFIAPSVPQQEERIQEATDLAQHL
YGLEEGQKYIEKIVTKHKEVLESVTELCESLTELEEKLKQGDVLKMNPNLEDFHYDYIDL
LKEPAKNKQTIFNEERNKGQVQVADLLGINGTGEERLPQDLKVSTDKEGGVQDLLLPEDM
LSGEEYECVSPDDISLPPLPGSPESPLAPSDMEVEEPVSSSLSLHISSYGVQAGTSSPGD
AQESVLPPPVAFADACNDKRETFSSHFERPYLQFKAEPPLTSRGFVEKSTALHRISAEHP
ESMMSEVHERALQQHPQAQGGLLETREKMHADNNFTKTQDRLHASSDAFSGLRFQSGTSR
GYQRQMVPREEIKSTSAKSSVVSLADQAPNFSRLLSNVTVMEGSPVTLEVEVTGFPEPTL
TWYKKGQKLSADGHLQVLHKETRHSVFIPKVCKADAGLYVARAQNSSGALSSNVILHVTG
NCRLPITRVNWITLCVVYVSVSLMYWLLTQ
Download sequence
Identical sequences NP_775919.3.87134 NP_775919.3.92137 ENSP00000395995 ENSP00000395995 gi|299829223|ref|NP_775919.3| ENSP00000395995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]