SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|299829259|ref|NP_001177739.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299829259|ref|NP_001177739.1|
Domain Number 1 Region: 467-579
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.62e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00056
Further Details:      
 
Domain Number 2 Region: 283-344,407-452
Classification Level Classification E-value
Superfamily PH domain-like 7.49e-20
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|299829259|ref|NP_001177739.1|
Domain Number - Region: 591-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00189
Family Ankyrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|299829259|ref|NP_001177739.1|
Sequence length 658
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 [Homo sapiens]
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGE
DLHMHQVRDREMPEALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDA
DRSLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKS
NGLSKDMDTGLGDSICFSPGISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCKSSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DCETQNPKWASLNLGVLMCIECSGIHRSFGTRLSRVRSLELDDWPVELRKVMSSIGNELA
NSIWEGSSQGQTKPSIKSTREEKEWWIRSKYEEKLFLAPLPCTELSLGQQLLRATTDEDL
QTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLEQLLTGWTSWPEMPTGTQR
Download sequence
Identical sequences ENSP00000392206 ENSP00000403270 ENSP00000463863 gi|299829259|ref|NP_001177739.1| NP_001177739.1.87134 NP_001177739.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]