SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300360532|ref|NP_001177931.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300360532|ref|NP_001177931.1|
Domain Number 1 Region: 24-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.73e-28
Family Glutathione S-transferase (GST), N-terminal domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 103-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.64e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300360532|ref|NP_001177931.1|
Sequence length 208
Comment glutathione S-transferase omega-1 isoform 2 [Homo sapiens]
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVS
ALLTSEKDWQGFLELYLQNSPEACDYGL
Download sequence
Identical sequences NP_001177931.1.87134 NP_001177931.1.92137 ENSP00000358724 gi|300360532|ref|NP_001177931.1| ENSP00000358724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]