SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300360567|ref|NP_001177942.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300360567|ref|NP_001177942.1|
Domain Number 1 Region: 24-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000628
Further Details:      
 
Domain Number 2 Region: 103-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300360567|ref|NP_001177942.1|
Sequence length 209
Comment glutathione S-transferase omega-2 isoform 2 [Homo sapiens]
Sequence
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVC
ALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Download sequence
Identical sequences ENSP00000390986 gi|300360567|ref|NP_001177942.1| NP_001177942.1.87134 NP_001177942.1.92137 ENSP00000390986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]