SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301172774|ref|NP_001180363.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|301172774|ref|NP_001180363.1|
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily PH domain-like 0.0447
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301172774|ref|NP_001180363.1|
Sequence length 366
Comment PH domain-containing protein C10orf81 isoform 2 [Homo sapiens]
Sequence
MQSVQKMFKCHPDEVMSIRTTNREYFLIGHDREKIKDWVSFMSSFRQDIKATQQNTEEEL
SLGNKRTLFYSSPLLGPSSTSEAVGSSSPRNGLQDKHLMEQSSPGFRQTHLQDLSEATQD
VKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHE
SVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGNIPDESQVEKLN
VFLSPPDVINYLALTEATGRICVSQWEGPPRLGCIFCHGDHLLAVNDLKPQSLEEVSLFL
TRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQ
QKGARE
Download sequence
Identical sequences NP_001180363.1.87134 NP_001180363.1.92137 NP_001180364.1.87134 NP_001180364.1.92137 ENSP00000358318 ENSP00000483759 gi|301172774|ref|NP_001180363.1| gi|301172784|ref|NP_001180364.1| ENSP00000358318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]