SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302058252|ref|NP_001180449.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302058252|ref|NP_001180449.1|
Domain Number 1 Region: 262-612
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-85
Family p120GAP domain-like 0.0000334
Further Details:      
 
Domain Number 2 Region: 568-710
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-33
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 3 Region: 113-253
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-29
Family Synaptotagmin-like (S variant) 0.0057
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.2e-26
Family PLC-like (P variant) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302058252|ref|NP_001180449.1|
Sequence length 806
Comment rasGAP-activating-like protein 1 isoform 1 [Homo sapiens]
Sequence
MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVH
LPLDFHQLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEI
CLSVQMLEDGQGRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHW
DEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVEFSPKTLQQKPPKGWFRLLPFPRAE
EDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQGPAEEDTASPLALLEELTLGD
CRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKSMEQFMKLVGM
PYLHEVLKPVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLG
PIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQQDVKYLAISGFLFLRFFAPAIL
TPKLFDLRDQHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVR
DFLDRLVDVDGDEEAGVPARALFPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLSGE
TLSFSKSPEWQMCHSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGTGALHTTYLQCKNVN
ELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDWSD
PLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEV
LADLDRAHEEFQQQERGKAALGPLGP
Download sequence
Identical sequences ENSP00000450244 NP_001180449.1.87134 NP_001180449.1.92137 XP_005254007.1.92137 XP_006719704.1.92137 XP_011537154.1.92137 gi|302058252|ref|NP_001180449.1| ENSP00000450244 ENSP00000448510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]