SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302632535|ref|NP_002953.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302632535|ref|NP_002953.2|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily EF-hand 1.65e-19
Family SCOPe 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302632535|ref|NP_002953.2|
Sequence length 92
Comment protein S100-A5 [Homo sapiens]
Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLD
KNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Download sequence
Identical sequences P33763
000135405|e2kaxA1|108.1.1.145|A:1-92 000366842|e2kaxB1|108.1.1.145|B:1-92 000366843|e2kayA1|108.1.1.145|A:1-92 000366844|e2kayB1|108.1.1.145|B:1-92 cath|current|2kaxA00/1-92 cath|current|2kaxB00/1-92 cath|current|2kayA00/1-92 cath|current|2kayB00/1-92 cath|current|4dirA00/2-87 cath|current|4dirB00/1-87 d2kaxa_ d2kaxb_ d2kaya_ d2kayb_ gi|302632535|ref|NP_002953.2| ENSP00000357706 ENSP00000357707 2kax_A 2kax_B 2kay_A 2kay_B 4dir_A 4dir_B ENSP00000357706 ENSP00000357707 NP_002953.2.87134 NP_002953.2.92137 XP_016857520.1.92137 XP_016857521.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]