SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|30410788|ref|NP_006756.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30410788|ref|NP_006756.2|
Domain Number 1 Region: 64-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000734
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30410788|ref|NP_006756.2|
Sequence length 348
Comment tumor suppressor candidate 3 isoform a [Homo sapiens]
Sequence
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE
Download sequence
Identical sequences A0A2I3LUF4 A0A2J8X3T1 A0A2K5M7W6 A0A2K5X4Y5 A0A2K5XMT8 A0A2K6DCD2 A0A2K6LZN2 A0A2K6P519 A0A2K6U5R7 G3RER4 H2RDL6 H9EQC2 Q13454 U3FMP3
ENSPTRP00000059071 gi|30410788|ref|NP_006756.2| ENSP00000423426 ENSPTRP00000059071 NP_001253208.1.72884 NP_006756.2.87134 NP_006756.2.92137 XP_002756954.1.60252 XP_003797704.1.62490 XP_004597895.1.84141 XP_004757892.1.14098 XP_005562702.1.63531 XP_006727456.1.47382 XP_007959903.1.81039 XP_009241828.1.23681 XP_009453114.1.37143 XP_010344389.1.74449 XP_010356457.1.97406 XP_011755573.1.29376 XP_011843733.1.47321 XP_011884835.1.92194 XP_016814608.1.37143 XP_017722688.1.44346 XP_018888200.1.27298 XP_018888201.1.27298 XP_020138369.1.48125 ENSP00000424544 9606.ENSP00000221167 ENSP00000424544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]