SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304555610|ref|NP_689560.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304555610|ref|NP_689560.3|
Domain Number 1 Region: 456-591
Classification Level Classification E-value
Superfamily EF-hand 7.49e-19
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 669-827
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000183
Family Calmodulin-like 0.004
Further Details:      
 
Domain Number 3 Region: 165-283
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000101
Family Calmodulin-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|304555610|ref|NP_689560.3|
Domain Number - Region: 598-662
Classification Level Classification E-value
Superfamily EF-hand 0.000306
Family Calmodulin-like 0.05
Further Details:      
 
Domain Number - Region: 845-897
Classification Level Classification E-value
Superfamily EF-hand 0.00119
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|304555610|ref|NP_689560.3|
Sequence length 973
Comment EF-hand domain-containing protein C17orf57 isoform A [Homo sapiens]
Sequence
METKVHLFCQAEENIDLLDDGSNSFATDLSSGTINHKKYIKFSKTIEKEISPEIRSLSPE
YKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENS
LCKLPNQYSVHKTSSPLCTSSAITREKEMLSNLYMTLYDEVTHGYLHSKELSALHKACKI
FSKIRSGKIYVNDLPVILCILRISISDLEMRQALKTVDIDAFQDALKIFCRIKGGRVSTD
DVFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPL
NEITSDRKLSSVAGCYLKYKKKNSLSSKLPEPSISKKLNKKSNQYYSKIMENDDLESKRP
KNTWQIRKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSLSKSL
DKSDISSIPKLQKPAVRKHSSLQKQVSSTEKTAISTLENFCEAISKLQENYIAAEELQSI
LPSTGINLLDEEFQKIVTDTSRNENGMVELDDFVNALAKERSFPECNALPGVIKAIDKIK
DKNVDYEDLNTCLQNFGIYLSKPEFKKITELTEAGETKKVNFKEFIDTMMSNTECFSEKL
VLPDAIETLDDLRKETMSVSDLWNTLSSLNSNLKKDEFLAALELVTVDEGDKVQFEEFAK
VVRNMRDAARLEELQEVVLAADLLEGDMIAGKNLEDFLRNVGIKSPKEEVEKILQSDFVS
EDNMVNIKDCMRALRDTQKFSNYIDFRKEASNLKLPKVNEIKEAANILSHVDNGKIGIPD
LEHALKCLNVNLTEEDFNEALNCCNVSDNMEVDLKDFLMKMKESPHFQKSKATQILLATT
QILQNDLVDVSDLKTLLMDKDLHTANAILTVMLRHVPEHESGKVSIQEFMTKLSDILTIP
KAAGKFYLICTYCPDLERQAVVYMLKTIQDSIVKAQVSKKQYNMNIKQHKISLHNFCLNS
KANIAKLNPNSKF
Download sequence
Identical sequences Q8IY85
ENSP00000332111 NP_689560.3.87134 NP_689560.3.92137 9606.ENSP00000332111 ENSP00000332111 ENSP00000332111 gi|304555610|ref|NP_689560.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]