SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305410789|ref|NP_001182031.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305410789|ref|NP_001182031.1|
Domain Number 1 Region: 64-214,305-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000111
Further Details:      
 
Domain Number 2 Region: 379-492
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.24e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000043
Further Details:      
 
Domain Number 3 Region: 212-324
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000302
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305410789|ref|NP_001182031.1|
Sequence length 493
Comment glutathione reductase, mitochondrial isoform 2 precursor [Homo sapiens]
Sequence
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCL
LWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAA
GRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTP
MYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVA
IHPTSSEELVTLR
Download sequence
Identical sequences gi|305410789|ref|NP_001182031.1| ENSP00000445516 NP_001182031.1.87134 NP_001182031.1.92137 ENSP00000445516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]