SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|306922384|ref|NP_001182448.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|306922384|ref|NP_001182448.1|
Domain Number 1 Region: 14-49,130-242
Classification Level Classification E-value
Superfamily EF-hand 3.04e-16
Family Penta-EF-hand proteins 0.061
Further Details:      
 
Domain Number 2 Region: 27-135
Classification Level Classification E-value
Superfamily EF-hand 0.0000525
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|306922384|ref|NP_001182448.1|
Sequence length 278
Comment calcium uptake protein 1, mitochondrial isoform 3 [Homo sapiens]
Sequence
MKRIYTYRRAKEIFKDTPKAPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGM
RHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPV
DGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVD
TALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMK
QRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ
Download sequence
Identical sequences ENSP00000402470 gi|306922384|ref|NP_001182448.1| ENSP00000402470 NP_001182448.1.87134 NP_001182448.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]