SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|306966146|ref|NP_001182465.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|306966146|ref|NP_001182465.1|
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.03
Further Details:      
 
Domain Number - Region: 97-168
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|306966146|ref|NP_001182465.1|
Sequence length 171
Comment charged multivesicular body protein 5 isoform 2 [Homo sapiens]
Sequence
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAGWSSGG
Download sequence
Identical sequences A0A1D5Q4W1 A0A2I2ZAA5 A0A2I3GK88 A0A2J8XIR2 A0A2K5HF82 A0A2K5NZH8 A0A2K5VTV7 A0A2K5YU83 A0A2K6CU67 K7AN79
ENSP00000442725 ENSP00000442725 NP_001182465.1.87134 NP_001182465.1.92137 XP_003263474.1.23891 XP_003312089.1.37143 XP_009242630.1.23681 XP_011781932.1.43180 XP_011835406.1.47321 gi|306966146|ref|NP_001182465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]