SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|306966160|ref|NP_001182474.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|306966160|ref|NP_001182474.1|
Domain Number 1 Region: 62-179
Classification Level Classification E-value
Superfamily L domain-like 1.02e-25
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|306966160|ref|NP_001182474.1|
Sequence length 275
Comment leucine-rich repeat-containing protein 3C [Homo sapiens]
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLPLLLVIGTGGTVPSPQVPPRGCYVAKEAGE
RTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSG
AAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPG
TGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLMVAYL
VHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Download sequence
Identical sequences A6NJW4
ENSP00000367157 NP_001182474.1.87134 NP_001182474.1.92137 XP_011522460.1.92137 XP_016879492.1.92137 ENSP00000367157 gi|306966160|ref|NP_001182474.1| 9606.ENSP00000367157 ENSP00000367157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]