SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307344641|ref|NP_001182537.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307344641|ref|NP_001182537.1|
Domain Number 1 Region: 141-291
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-34
Family Pleckstrin-homology domain (PH domain) 0.00000567
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-22
Family Pleckstrin-homology domain (PH domain) 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307344641|ref|NP_001182537.1|
Sequence length 334
Comment pleckstrin homology domain-containing family A member 1 isoform 2 [Homo sapiens]
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIK
LTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSD
SQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLP
YFTPKPPQDSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEV
HKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSASS
MRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS
Download sequence
Identical sequences A0A2J8W6F3 K7C9M0
ENSP00000438608 gi|307344641|ref|NP_001182537.1| ENSP00000357984 NP_001182537.1.87134 NP_001182537.1.92137 XP_005270078.1.92137 XP_008949263.1.60992 XP_009244135.1.23681 XP_009244136.1.23681 XP_016775030.1.37143 XP_016871979.1.92137 XP_016871980.1.92137 XP_018890502.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]