SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307691184|ref|NP_001182665.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307691184|ref|NP_001182665.1|
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000575
Family Thioltransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307691184|ref|NP_001182665.1|
Sequence length 246
Comment prostamide/prostaglandin F synthase isoform a [Homo sapiens]
Sequence
MSRERGSRSEEPGAGNRESGSREPGLAAAAMSTVDLARVGACILKHAVTGEAVELRSLWR
EHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGE
LYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAV
GIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPP
QCDREV
Download sequence
Identical sequences A0A0A0MT35
NP_001182665.1.87134 NP_001182665.1.92137 ENSP00000413218 ENSP00000477600 gi|307691184|ref|NP_001182665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]