SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307691192|ref|NP_001182669.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307691192|ref|NP_001182669.1|
Domain Number 1 Region: 47-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000137
Family Thioltransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307691192|ref|NP_001182669.1|
Sequence length 192
Comment prostamide/prostaglandin F synthase isoform e [Homo sapiens]
Sequence
MSRERGSRSEEPGAGNRESGSREPGLAAAAMSTVDLARVGACILKHAVTGEAVELRSLWR
EHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGE
LYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKKSPGDYVPKEHILQVLGISAEV
CASDPPQCDREV
Download sequence
Identical sequences A0A0A0MRV4
NP_001182669.1.87134 NP_001182669.1.92137 ENSP00000367682 ENSP00000479869 gi|307691192|ref|NP_001182669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]