SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308153253|ref|NP_683704.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308153253|ref|NP_683704.2|
Domain Number 1 Region: 352-713
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.14e-119
Family Oxysterol-binding protein 0.0000102
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-18
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|308153253|ref|NP_683704.2|
Sequence length 719
Comment oxysterol-binding protein-related protein 9 isoform b [Homo sapiens]
Sequence
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTGAVIGIDDEDDSTFTITVDQKTF
HFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFDKKLTEADAYLQILIEQL
KLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKDQSNAEKHADGMISTI
NPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPN
STGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGS
ASVLTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMH
LLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWY
LSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAE
QVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTF
PNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKS
FCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLK
IRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences A0A2I3TVJ4
NP_683704.2.87134 NP_683704.2.92137 ENSP00000413263 gi|308153253|ref|NP_683704.2| ENSP00000413263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]