SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308737010|ref|NP_001184189.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308737010|ref|NP_001184189.1|
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-35
Family Phosphotyrosine-binding domain (PTB) 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|308737010|ref|NP_001184189.1|
Sequence length 342
Comment docking protein 1 isoform 2 [Homo sapiens]
Sequence
MLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLL
SWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAG
QGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPL
DSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDL
PREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGS
GIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST
Download sequence
Identical sequences gi|308737010|ref|NP_001184189.1| NP_001184189.1.87134 NP_001184189.1.92137 NP_001305795.1.87134 NP_001305795.1.92137 ENSP00000387016 ENSP00000387016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]