SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308818206|ref|NP_001184225.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308818206|ref|NP_001184225.1|
Domain Number 1 Region: 305-626
Classification Level Classification E-value
Superfamily L domain-like 2.21e-47
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 101-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family VWC domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308818206|ref|NP_001184225.1|
Sequence length 643
Comment extracellular matrix protein 2 isoform 3 precursor [Homo sapiens]
Sequence
MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTV
FTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEP
CTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGM
DRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAH
QQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSL
SYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGLPNLERLDLSKNNITSS
GIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSDLNQLVT
LELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITE
ICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLV
LLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKS
IPPGIQEMKALHFLRLNNNKIRCVSDAVLETVTNRSDVAFPLW
Download sequence
Identical sequences NP_001184225.1.87134 NP_001184225.1.92137 gi|308818206|ref|NP_001184225.1| ENSP00000393971 ENSP00000393971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]