SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310124856|ref|XP_003119308.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310124856|ref|XP_003119308.1|
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.58e-45
Family MHC antigen-recognition domain 0.0000068
Further Details:      
 
Domain Number 2 Region: 129-217
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-26
Family C1 set domains (antibody constant domain-like) 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310124856|ref|XP_003119308.1|
Sequence length 266
Comment PREDICTED: HLA class II histocompatibility antigen, DRB1-7 beta chain-like isoform 2 [Homo sapiens]
Sequence
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLWQGKYKCHFFNGTERVQFLERLF
YNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTV
QRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
Download sequence
Identical sequences D7RIG5 P13761
XP_011546040.1.92137 ENSP00000405960 ENSP00000409322 ENSP00000392880 ENSP00000409322 gi|310124854|ref|XP_003119307.1| gi|310124856|ref|XP_003119308.1| gi|310124934|ref|XP_003119339.1| gi|310124936|ref|XP_003119340.1| ENSP00000405960 ENSP00000409322 ENSP00000481636 ENSP00000482190 NYSGRC-IgSF-2B17_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]