SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310832410|ref|NP_001185594.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310832410|ref|NP_001185594.1|
Domain Number 1 Region: 351-539
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.41e-66
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 
Domain Number 2 Region: 748-977
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-64
Family DBL homology domain (DH-domain) 0.000000000662
Further Details:      
 
Domain Number 3 Region: 981-1111
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-39
Family Pleckstrin-homology domain (PH domain) 0.0000012
Further Details:      
 
Domain Number 4 Region: 41-130
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310832410|ref|NP_001185594.1|
Sequence length 1525
Comment rho guanine nucleotide exchange factor 12 isoform 2 [Homo sapiens]
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTGLVQRCVIIQKDD
NGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSY
VALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEENN
VVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKATGS
AQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIY
LEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLK
SRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVS
VPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELT
KLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKV
KEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSILGPPRRPSRHDNSAIGRAM
ELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGYLPANSMSSVASGASFSQEG
GKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQVQEEECEVERVTEHGTPKP
FRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTE
RAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETS
VIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNP
LCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVK
EAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLY
TLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATDNKALFV
ISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPLPQSTPGEGDNDEEDP
SKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTSGKSEVRDLFVAERQFAKEQ
HTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLKQLLVQQLGLTEKSVQEDWQ
HFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTGDIATCYSPRTSTESFAPRD
SVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEHFFDAREAHSDENPSEGDGA
VNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQ
NTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLKK
VEESYTILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences gi|310832410|ref|NP_001185594.1| NP_001185594.1.87134 NP_001185594.1.92137 ENSP00000349056 ISFI311 ENSP00000349056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]