SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311213852|ref|NP_001185655.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311213852|ref|NP_001185655.1|
Domain Number 1 Region: 14-154
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.03e-28
Family CRAL/TRIO domain 0.0033
Further Details:      
 
Domain Number 2 Region: 188-296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-26
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311213852|ref|NP_001185655.1|
Sequence length 305
Comment rho GTPase-activating protein 8 isoform 3 [Homo sapiens]
Sequence
MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKY
TLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIKVL
WNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPTK
TPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTV
REIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVPGEHLQ
QNEQL
Download sequence
Identical sequences ENSP00000337287 ENSP00000478661 ENSP00000337287 gi|311213852|ref|NP_001185655.1| NP_001185655.1.87134 NP_001185655.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]