SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311771742|ref|NP_001185741.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311771742|ref|NP_001185741.1|
Domain Number 1 Region: 152-217
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000139
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 2 Region: 344-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000106
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 252-309
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000499
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311771742|ref|NP_001185741.1|
Sequence length 454
Comment C9orf30-TMEFF1 fusion protein [Homo sapiens]
Sequence
MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQP
SVSLRDFKQLKKCWENIKARTKKIMAHERREKVKRSVSPLLSTHVLGKEKIASMLPEQLY
FLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTN
YIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRK
HSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQ
IDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHG
KCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVA
IVMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences gi|311771742|ref|NP_001185741.1| NP_001185741.1.87134 NP_001185741.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]