SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312147259|ref|NP_001185868.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312147259|ref|NP_001185868.1|
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 1.46e-37
Family EF-hand modules in multidomain proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 1.59e-30
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 219-297
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312147259|ref|NP_001185868.1|
Sequence length 690
Comment dystrobrevin alpha isoform 11 [Homo sapiens]
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFIT
RSMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELE
NKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRR
ELMVQLEGLMKLLKEEELKQGTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDS
LTGVGGDVQEAFAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFAR
TQFEDLVPSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDADPYVQPEDENYEND
SVRQLENELQMEEYLKQKLQDEAYQVSLQG
Download sequence
Identical sequences NP_001185868.1.87134 NP_001185868.1.92137 ENSP00000382072 ENSP00000382072 gi|312147259|ref|NP_001185868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]