SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312147286|ref|NP_001185874.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312147286|ref|NP_001185874.1|
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 1.98e-38
Family EF-hand modules in multidomain proteins 0.0031
Further Details:      
 
Domain Number 2 Region: 143-202
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000313
Family EF-hand modules in multidomain proteins 0.026
Further Details:      
 
Weak hits

Sequence:  gi|312147286|ref|NP_001185874.1|
Domain Number - Region: 226-296
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0889
Family Seryl-tRNA synthetase (SerRS) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312147286|ref|NP_001185874.1|
Sequence length 320
Comment dystrobrevin alpha isoform 17 [Homo sapiens]
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQQPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEI
QRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLM
KLLKEEELKQGVSYVPYCRS
Download sequence
Identical sequences A0A2I2Y761 A0A2J8MM47
ENSP00000469121 ENSP00000469121 gi|312147286|ref|NP_001185874.1| NP_001185874.1.87134 NP_001185874.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]