SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312222719|ref|NP_001185947.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312222719|ref|NP_001185947.1|
Domain Number 1 Region: 23-261
Classification Level Classification E-value
Superfamily L domain-like 2.72e-33
Family Internalin LRR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312222719|ref|NP_001185947.1|
Sequence length 642
Comment leucine-rich repeat-containing protein 49 isoform 3 [Homo sapiens]
Sequence
MRSITQGACRFIWEDKGYISGDHINLVSSSLSSFPILQRSSEEKILYSDRLSLERQKLTV
CPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLG
KNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSL
TELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQE
SWYKHTVLQNMMQLRQLDMKRITEEERRMASVLAKKEEEKKRESHKQSLLKEKKRLTINN
VARQWDLQQQRVANIATNEDRKDSDSPQDPCQIDGSTLSAFPEETGPLDSGLNNALQGLS
VIDTYLVEVDGDTLSLYGSGALESLDRNWSVQTAGMITTVSFTFIEFDEIVQVLPKLKIK
FPNSLHLKFKETNLVMLQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSM
QKINGTEVTQNDMIMAERLFGILAHVASSELPQYRLISILGDARKKQFRYLLESKGKKPG
IINEENNDSKRLVGENTNRATLNYTTRDFYNEKLEEIKEKKKFCKTYIEDLVKEATEINM
KNEALQKLWPQMFIELVRDAVIEIRNKNSYMKLCLQQITDQK
Download sequence
Identical sequences ENSP00000414065 gi|312222719|ref|NP_001185947.1| NP_001185947.1.87134 NP_001185947.1.92137 XP_011520017.1.92137 XP_016877847.1.92137 ENSP00000414065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]