SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312283621|ref|NP_001186009.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312283621|ref|NP_001186009.1|
Domain Number 1 Region: 99-374
Classification Level Classification E-value
Superfamily L domain-like 1.12e-50
Family Ngr ectodomain-like 0.0099
Further Details:      
 
Domain Number 2 Region: 380-619
Classification Level Classification E-value
Superfamily L domain-like 2.45e-47
Family Ngr ectodomain-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312283621|ref|NP_001186009.1|
Sequence length 642
Comment podocan isoform 2 [Homo sapiens]
Sequence
MEGEEAEQPAWFRQPWRPGASDSAPPAGTMAQSRVLLLLLLLPPQLHLGPVLAVRAPGFG
RSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACSQEGVVDCGGIDLREFP
GDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNYL
YLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNNKLADAGLPDN
MFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFSELSSLRELYLQN
NYLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLVLLHLEKNAIRSVDANVLTP
IRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALERVPSGLPRRVRTLMILHNQ
ITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRLHTLPPGLPR
NVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGN
QLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSAFRRL
KHLQVLDIEGNLEFGDISKDRGRLGKEKEEEEEEEEEEEETR
Download sequence
Identical sequences gi|312283621|ref|NP_001186009.1| gi|312283625|ref|NP_001186010.1| ENSP00000360555 ENSP00000360555 ENSP00000479233 NP_001186009.1.87134 NP_001186009.1.92137 NP_001186010.1.87134 NP_001186010.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]