SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312433998|ref|NP_001186078.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312433998|ref|NP_001186078.1|
Domain Number 1 Region: 310-666
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-147
Family Transferrin 0.00000000000128
Further Details:      
 
Domain Number 2 Region: 4-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-117
Family Transferrin 0.0000000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312433998|ref|NP_001186078.1|
Sequence length 666
Comment lactotransferrin isoform 2 [Homo sapiens]
Sequence
MRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTE
RQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPI
EAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGD
VAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKED
AIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYF
TAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVL
KGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSD
TSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCA
LCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKD
LKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGS
DCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEA
CEFLRK
Download sequence
Identical sequences gi|312433998|ref|NP_001186078.1| ENSP00000405719 NP_001186078.1.87134 NP_001186078.1.92137 ENSP00000405719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]