SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31317231|ref|NP_851939.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31317231|ref|NP_851939.1|
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-33
Family FKBP immunophilin/proline isomerase 0.00023
Further Details:      
 
Domain Number 2 Region: 151-217
Classification Level Classification E-value
Superfamily EF-hand 0.000000000187
Family Calbindin D9K 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31317231|ref|NP_851939.1|
Sequence length 222
Comment peptidyl-prolyl cis-trans isomerase FKBP7 isoform a precursor [Homo sapiens]
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEK
DEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Download sequence
Identical sequences Q9Y680
NP_851939.1.87134 NP_851939.1.92137 ENSP00000413152 9606.ENSP00000413152 ENSP00000233092 ENSP00000413152 gi|31317231|ref|NP_851939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]