SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313747541|ref|NP_001186456.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313747541|ref|NP_001186456.1|
Domain Number 1 Region: 242-328,750-834
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000305
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 2 Region: 41-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000183
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000341
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 189-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000073
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|313747541|ref|NP_001186456.1|
Domain Number - Region: 946-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000226
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 319-403
Classification Level Classification E-value
Superfamily SEA domain 0.000353
Family SEA domain 0.012
Further Details:      
 
Domain Number - Region: 850-889
Classification Level Classification E-value
Superfamily SEA domain 0.0654
Family SEA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313747541|ref|NP_001186456.1|
Sequence length 1374
Comment uromodulin-like 1 isoform 3 [Homo sapiens]
Sequence
MVYRTQYLVVEVPESRNVTDCCEGYEQLGLYCVLPLNQSGQFTSRPGACPAEGPEPSTSP
CSLDIDCPGLEKCCPWSGGRYCMAPAPQAPERDPVGSWYNVTILVKMDFKELQQVDPRLL
NHMRLLHSLVTSALQPMASTVHHLHSAPGNASTTVSRLLLGLPRPLPVADVSTLLGDIAK
RVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDC
PPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRSARTQSQALAVAGLEAGV
LYRVKTSYQGCGADVSTTLTIKTNAQVFEVTIKIVNHNLTEKLLNRSSVEYQDFSRQLLH
EVESSFPPVVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGISTLAPILQPLLA
STVFQIDRQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTRDATPSRAGRACE
GDLVSPTGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPAAGQAWTPEPSPR
RGGSNVVGYDRNNTGKGVEQEVPSTAPGLGMDQGSPSQVNPSQGSPSQGSLRQESTSQAS
PSQRSTSQGSPSQVNPSQRSTSHANSSQGSPSQGSPSQESPSQGSTSQASPSHRNTIGVI
GTTSSPKATGSTHSFPPGATDGPLALPGQLQGNSIMEPPSWPSPTEDPTGHFLWHATRST
RETLLNPTWLRNEDSGPSGSVDLPLTSTLTALKTPACVPVSIGRIMVSNVTSTGFHLAWE
ADLAMDSTFQLTLTSMWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAKACGKEGARAHLK
VRTAARKLIGKVRIKNVRYSESFRNASSQEYRDFLELFFRMVRGSLPATMCQHMDAGGVR
MEVVSVTNGSIVVEFHLLIIADVDVQEVSAAFLTAFQTVPLLEVIRGDTFIQDYDECERK
EDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWATSPERPLTTAGT
KAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESIPESSLYLSHPSC
NVSHSNGTHVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHHLKILSPIYCAFQ
NDLLTSSGFTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVRIEVGLY
RQKSNLKVVLTECWATPSSNARDPITFSFINNSCPVPNTYTNVIENGNSNKAQFKLRIFS
FINDSIVYLHCKLRVCMESPGATCKINCNNFRLLQNSETSATHQMSWGPLIRSEGEPPHA
EAGLGAGYVVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFSYQVFYE
Download sequence
Identical sequences NP_001186456.1.87134 NP_001186456.1.92137 gi|313747541|ref|NP_001186456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]