SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31377557|ref|NP_710157.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31377557|ref|NP_710157.2|
Domain Number 1 Region: 56-206
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-25
Family Phosphotyrosine-binding domain (PTB) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31377557|ref|NP_710157.2|
Sequence length 423
Comment hypothetical protein LOC131583 [Homo sapiens]
Sequence
MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKK
LHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRM
VHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEK
AQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHTIPLVPLRKLLLHGPCCYKPP
VERSRSAPKLGSITEDLLGEQLEQELQEEEEEEQPEGCPEEEENRAAEGDPAEEEAEAQR
ALVVAMHFECGDLLDTLENGRGEALGGGGGSLGPGAGPPPLLLGSASDMKAELSQLISDL
GELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
HSG
Download sequence
Identical sequences Q8N2R8
gi|31377557|ref|NP_710157.2| ENSP00000371397 9606.ENSP00000371397 NP_710157.2.87134 NP_710157.2.92137 ENSP00000371397 ENSP00000371397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]