SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31377568|ref|NP_689966.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31377568|ref|NP_689966.2|
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 276-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 240-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000006
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 624-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000257
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 201-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000583
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31377568|ref|NP_689966.2|
Sequence length 993
Comment signal peptide, CUB and EGF-like domain-containing protein 3 precursor [Homo sapiens]
Sequence
MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHIKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGITHCGDVDE
CSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIK
QRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLTLELEAEVRAEETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCS
RCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences K7C6I2 Q8IX30
NP_689966.2.87134 NP_689966.2.92137 XP_016810785.1.37143 gi|31377568|ref|NP_689966.2| 9606.ENSP00000274938 ENSP00000274938 ENSP00000274938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]