SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31377720|ref|NP_067635.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31377720|ref|NP_067635.2|
Domain Number 1 Region: 141-291
Classification Level Classification E-value
Superfamily PH domain-like 7.55e-34
Family Pleckstrin-homology domain (PH domain) 0.00000567
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 3.27e-22
Family Pleckstrin-homology domain (PH domain) 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|31377720|ref|NP_067635.2|
Sequence length 404
Comment pleckstrin homology domain-containing family A member 1 isoform 1 [Homo sapiens]
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIK
LTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSD
SQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLP
YFTPKPPQDSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEV
HKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSASS
EHPPGPSESKHAFRPTNAATATSHSTASRSNSLVSTFTMEKRGFYESLAKVKPGNFKVQT
VSPREPASKVTEQALLRPQSKNGPQEKDCDLVDLDDASLPVSDV
Download sequence
Identical sequences Q9HB21
ENSP00000357984 gi|31377720|ref|NP_067635.2| gi|50234893|ref|NP_001001974.1| NP_001001974.1.87134 NP_001001974.1.92137 NP_067635.2.87134 NP_067635.2.92137 XP_005270073.1.92137 XP_016871969.1.92137 XP_016871970.1.92137 XP_016871971.1.92137 ENSP00000357986 ENSP00000376547 ENSP00000394416 9606.ENSP00000357986 ENSP00000357986 ENSP00000376547 ENSP00000394416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]