SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313851001|ref|NP_001186558.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313851001|ref|NP_001186558.1|
Domain Number 1 Region: 61-206
Classification Level Classification E-value
Superfamily EF-hand 5.07e-39
Family Calmodulin-like 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313851001|ref|NP_001186558.1|
Sequence length 208
Comment myosin light chain 6B [Homo sapiens]
Sequence
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEE
EVETVLAGHEDSNGCINYEAFLKHILSV
Download sequence
Identical sequences A0A024RB31 P14649
NP_001186558.1.87134 NP_001186558.1.92137 NP_002466.1.87134 NP_002466.1.92137 9606.ENSP00000207437 gi|313851001|ref|NP_001186558.1| gi|4505303|ref|NP_002466.1| ENSP00000207437 ENSP00000446643 ENSP00000450385 ENSP00000446643 ENSP00000450385 ENSP00000207437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]