SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|314122177|ref|NP_001186600.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|314122177|ref|NP_001186600.1|
Domain Number 1 Region: 162-317
Classification Level Classification E-value
Superfamily EF-hand 5.45e-28
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily EF-hand 1.37e-17
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|314122177|ref|NP_001186600.1|
Sequence length 323
Comment calumenin isoform c precursor [Homo sapiens]
Sequence
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAF
LGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQ
WKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKT
EREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVD
KYDLFVGSQATDFGEALVRHDEF
Download sequence
Identical sequences A0A096NUC6 A0A1D5R3Z1 A0A2I3HHH7 A0A2I3T2X3 A0A2K5JLG8 A0A2K6AHG8 A0A2K6QUI7
ENSP00000420381 ENSP00000417973 ENSP00000420381 NP_001186600.1.87134 NP_001186600.1.92137 XP_009452280.1.37143 XP_010377043.1.97406 XP_011794944.1.43180 XP_011794945.1.43180 XP_011851296.1.47321 XP_011851298.1.47321 XP_014201297.1.60992 gi|314122177|ref|NP_001186600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]