SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|314122181|ref|NP_001186602.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|314122181|ref|NP_001186602.1|
Domain Number 1 Region: 64-215
Classification Level Classification E-value
Superfamily EF-hand 8.43e-27
Family Calmodulin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|314122181|ref|NP_001186602.1|
Sequence length 224
Comment calumenin isoform e precursor [Homo sapiens]
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNE
DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGWQAYQGGDR
Download sequence
Identical sequences A0A1D5R5Q3 A0A2I2Y6Y5 A0A2I3LW82 A0A2I3RG09 A0A2K5JLJ5 A0A2K5P6U2 A0A2K5V7J6 A0A2K6AHK1 A0A2K6BGX3 A0A2K6QUJ7 G1RPA1
gi|314122181|ref|NP_001186602.1| NP_001186602.1.87134 NP_001186602.1.92137 XP_003261347.1.23891 XP_011794950.1.43180 XP_011851301.1.47321 ENSP00000442110 ENSP00000442110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]