SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31542207|ref|NP_775815.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31542207|ref|NP_775815.2|
Domain Number 1 Region: 100-225
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000198
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  gi|31542207|ref|NP_775815.2|
Domain Number - Region: 330-409
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0209
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|31542207|ref|NP_775815.2|
Sequence length 697
Comment niban-like protein 2 isoform a [Homo sapiens]
Sequence
MGPDRKEVPLSRGTQAVVVGKGRGAPGDDSSMGGRPSSPLDKQQRQHLRGQVDTLLRNFL
PCYRGQLAASVLRQISRELGPQEPTGSQLLRSKKLPRVREHRGPLTQLRGHPPRWQPIFC
VLRGDGRLEWFSHKEEYENGGHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEE
PDSLLEVPVSFPLFLQHPFRRHLCFSAATREAQHAWRLALQGGIRLQGTVLQRSQAPAAR
AFLDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLPALRAQTLPGLRGAGRARAWA
WTELLDAVHAAVLAGASAGLCAFQPEKDELLASLEKTIRPDVDQLLRQRARVAGRLRTDI
RGPLESCLRREVDPQLPRVVQTLLRTVEASLEAVRTLLAQGMDRLSHRLRQSPSGTRLRR
EVYSFGEMPWDLALMQTCYREAERSRGRLGQLAAPFGFLGMQSLVFGAQDLAQQLMADAV
ATFLQLADQCLTTALNCDQAAQRLERVRGRVLKKFKSDSGLAQRRFIRGWGLCIFLPFVL
SQLEPGCKKELPEFEGDVLAVGSQALTTEGIYEDVIRGCLLQRIDQELKKTLGANDVSCT
LDGCLEVPWEQEGAAPNLNLVSSFLAGRQAFTDFLCLPAKSSANWILAASLLSCSCFRSG
FHRDSRVFLVQLAEGLSHSLETVSSHSVWSFRPTPRQ
Download sequence
Identical sequences NP_775815.2.87134 NP_775815.2.92137 gi|31542207|ref|NP_775815.2| NYSGRC-31542207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]