SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31542242|ref|NP_060387.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31542242|ref|NP_060387.2|
Domain Number 1 Region: 258-413
Classification Level Classification E-value
Superfamily EF-hand 6.12e-21
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 2 Region: 94-250
Classification Level Classification E-value
Superfamily EF-hand 0.00000193
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31542242|ref|NP_060387.2|
Sequence length 453
Comment serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma [Homo sapiens]
Sequence
MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENSADLDDT
Download sequence
Identical sequences G2HGB5 Q969Q6
ENSP00000261475 ENSP00000261475 GO.36700 gi|31542242|ref|NP_060387.2| ENSPTRP00000010629 NP_001233583.1.37143 NP_060387.2.87134 NP_060387.2.92137 XP_003821242.1.60992 XP_005267839.1.92137 XP_014203029.1.60992 XP_016781232.1.37143 9598.ENSPTRP00000010629 9606.ENSP00000261475 ENSP00000261475 ENSPTRP00000010629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]