SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31542504|ref|NP_001336.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31542504|ref|NP_001336.2|
Domain Number 1 Region: 376-614,647-714
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.13e-52
Family Diacylglycerol kinase-like 0.024
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily EF-hand 4.71e-48
Family EF-hand modules in multidomain proteins 0.000002
Further Details:      
 
Domain Number 3 Region: 186-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 4 Region: 45-58,105-183
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000962
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 5 Region: 256-324
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000882
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31542504|ref|NP_001336.2|
Sequence length 735
Comment diacylglycerol kinase alpha [Homo sapiens]
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
Download sequence
Identical sequences A0A024RB23 G3RDT9 H2Q668 P23743
ENSPTRP00000008625 ENSP00000328405 ENSP00000377703 ENSP00000450359 ENSP00000328405 ENSP00000377703 ENSP00000450359 NP_001336.2.87134 NP_001336.2.92137 NP_958852.1.87134 NP_958852.1.92137 NP_958853.1.87134 NP_958853.1.92137 NP_963848.1.87134 NP_963848.1.92137 XP_001169899.1.37143 XP_001169923.1.37143 XP_001169946.1.37143 XP_001169972.1.37143 XP_004053380.1.27298 XP_004053381.1.27298 XP_011536293.1.92137 XP_011536295.1.92137 XP_018893848.1.27298 XP_018893849.1.27298 HR6346 gi|31542504|ref|NP_001336.2| gi|41393587|ref|NP_958852.1| gi|41872494|ref|NP_958853.1| gi|41872500|ref|NP_963848.1| ENSPTRP00000008625 ENSP00000328405 9598.ENSPTRP00000008625 9606.ENSP00000328405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]