SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31542528|ref|NP_056324.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31542528|ref|NP_056324.2|
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-55
Family Necap1 N-terminal domain-like 0.000000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31542528|ref|NP_056324.2|
Sequence length 275
Comment adaptin ear-binding coat-associated protein 1 [Homo sapiens]
Sequence
MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWVKQESEISKESQEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTAR
GGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTP
APTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF
Download sequence
Identical sequences Q8NC96
9606.ENSP00000341737 gi|31542528|ref|NP_056324.2| NP_056324.2.87134 NP_056324.2.92137 ENSP00000341737 ENSP00000341737 ENSP00000341737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]