SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31621309|ref|NP_036604.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31621309|ref|NP_036604.2|
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 7.82e-30
Family U2A'-like 0.026
Further Details:      
 
Weak hits

Sequence:  gi|31621309|ref|NP_036604.2|
Domain Number - Region: 316-384
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000107
Family Nuclear movement domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|31621309|ref|NP_036604.2|
Sequence length 466
Comment leucine-rich repeat-containing protein 6 [Homo sapiens]
Sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL
MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKR
AKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDHLQAPDTEEHNTKKL
DNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSEKKKKVKPPRTLITEDGKALN
VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPFQLVLPAEVKP
DSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI
Download sequence
Identical sequences Q86X45
ENSP00000429791 ENSP00000484634 gi|31621309|ref|NP_036604.2| 9606.ENSP00000250173 ENSP00000250173 NP_036604.2.87134 NP_036604.2.92137 ENSP00000250173 ENSP00000429791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]